PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OGLUM04G20690.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family HD-ZIP
Protein Properties Length: 247aa    MW: 27305.1 Da    PI: 8.9349
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OGLUM04G20690.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox60.82.1e-1981135256
                      T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
         Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                      rk+ +++k+q  +Le+ F+++++++ ++++ LA++lgL  rqV vWFqNrRa+ k
  OGLUM04G20690.1  81 RKKLRLSKDQSAVLEDSFREHPTLNPRQKATLAQQLGLRPRQVEVWFQNRRARTK 135
                      788899***********************************************98 PP

2HD-ZIP_I/II1292e-4181170191
      HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                      +kk+rlsk+q+++LE+sF+e+ +L+p++K++la++Lgl+prqv+vWFqnrRARtk+kq+E+d+e+Lkr++++l+een+rL+kev+eLr +l
  OGLUM04G20690.1  81 RKKLRLSKDQSAVLEDSFREHPTLNPRQKATLAQQLGLRPRQVEVWFQNRRARTKLKQTEVDCEFLKRCCETLTEENRRLQKEVQELR-AL 170
                      69*************************************************************************************9.55 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.608.3E-1966131IPR009057Homeodomain-like
SuperFamilySSF466897.94E-1972138IPR009057Homeodomain-like
PROSITE profilePS5007117.34677137IPR001356Homeobox domain
SMARTSM003898.3E-1879141IPR001356Homeobox domain
PfamPF000468.8E-1781135IPR001356Homeobox domain
CDDcd000865.09E-1681138No hitNo description
PRINTSPR000314.9E-6108117IPR000047Helix-turn-helix motif
PROSITE patternPS000270112135IPR017970Homeobox, conserved site
PRINTSPR000314.9E-6117133IPR000047Helix-turn-helix motif
SMARTSM003402.7E-24137181IPR003106Leucine zipper, homeobox-associated
PfamPF021832.3E-11137171IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 247 aa     Download sequence    Send to blast
MMERAEDLRL SLSLSSPLIA PRTHHVAMLF HAPPEKRFLE MPLLPAAKRS EVVAAEEERA  60
GLRGGGGSDE EDGGCGIDGS RKKLRLSKDQ SAVLEDSFRE HPTLNPRQKA TLAQQLGLRP  120
RQVEVWFQNR RARTKLKQTE VDCEFLKRCC ETLTEENRRL QKEVQELRAL KLVSPHLYMN  180
MSPPTTLTMC PSCERVSNTN NNSSAAAAAD RRGIRTTTAA AGGSVVDTAA DGGILCHRPI  240
AVRPQQS
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
17985SRKKLRL
2129137RRARTKLKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1220060.0AK122006.1 Oryza sativa Japonica Group cDNA clone:J033110O17, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015634538.10.0PREDICTED: homeobox-leucine zipper protein HOX17
SwissprotQ01I230.0HOX17_ORYSI; Homeobox-leucine zipper protein HOX17
TrEMBLA0A0D3FYM60.0A0A0D3FYM6_9ORYZ; Uncharacterized protein
TrEMBLA0A0E0H3W10.0A0A0E0H3W1_ORYNI; Uncharacterized protein
TrEMBLI1PNL20.0I1PNL2_ORYGL; Uncharacterized protein
TrEMBLA0A0D9ZNV60.0A0A0D9ZNV6_9ORYZ; Uncharacterized protein
STRINGBGIOSGA014600-PA0.0(Oryza sativa Indica Group)
STRINGORGLA04G0178100.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP25873889
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G44910.13e-65homeobox-leucine zipper protein 4